mAb anti-LCRMP4, 5H5

$220.00$360.00

Mouse monoclonal antibody against the long isoform of human Collapsin Response Mediator Protein 4 (LCRMP4), Clone 5H5

$220.00
$360.00
SKU: MO-M40101A
Category:
Datasheet attachments:

Description

Description: Mouse monoclonal antibody against the long isoform of human Collapsin Response Mediator Protein 4 (LCRMP4). 

Purification: Protein G affinity purified

Product Type: Primary antibody, can be used as capture antibody in immunoassay

Target Protein: Human LCRMP4

Immunogen: The N-terminal 127 amino acids of LCRMP4. Below is the amino acid sequence: masgrrgwdssheddlpvylarpgttdqvprqkyggmfcnvegafesktldfdalsvgqrgaktprsgqgsdrgsgsrpgiegdtprrgqgreesrepapaspapagveirsatgkevlqnlgpkdk.

Fusion Myeloma: Sp2/0-Ag14

Specificity: LCRMP4 .

Species Reactivity: Human, others not tested.

Host / Isotype: Mouse, IgG1 Kappa

Formulation: Lyophilized in a 0.01M pH7.2 phosphate buffer solution

Reconstitution: Double distilled water is recommended to adjust the final concentration to 1.00 mg/mL.

Storage: Store at -20oC

Research Area: Neurology. Prostate cancer.

Background: 

CRMP4 belongs to the collapsin response mediator protein (CRMP) family that includes CRMP 1-5. CRMPs are highly expressed in the nervous system during brain development. It is also found that CRMP4 is inversely associated with lymph node metastasis of prostate cancers and that the methylation of the CpG island within the promoter region of CRMP4 gene down- regulates CRMP4 expression (Xin Gao et al. 2010; Ke Li et al. 2015). Recently, Dr. Xin Gao’s lab found that a long-form CRMP4 (LCRMP4) is potentially useful as a serum biomarker for prostate cancers.

Application:

1. ELISA & Chemiluminescence Assay

In combination with biotin conjugated antibody clone 2H7, clone 5H5 can be used as capture antibody for quantitative detection of LCRMP4 in sandwich ELISA and chemiluminescence assay. The ELISA assay range is around 2500pg/mL to 19pg/mL. 

References:

Xin Gao et al. Expression profiling identifies new function of collapsin response mediator protein 4 as a metastasis-suppressor in prostate cancer. Oncogene. 2010, 29, 4555–4566Ke Li et al. Manipulation of prostate cancer metastasis by locus-specific modification of the CRMP4 promoter region using chimeric TALE DNA methyltransferase and demethylase. Oncotarget. 2015, 6(12), 10030-10044If research is published using this product, please inform Anogen in order to cite the reference on this datasheet. Anogen will provide one unit of product in the same category as gratitude..

Reviews

There are no reviews yet.

Be the first to review “mAb anti-LCRMP4, 5H5”

Your email address will not be published. Required fields are marked *